| Paralogue | Variant | Associated Disease | Mapping Quality | Consensus | Pubmed |
|---|---|---|---|---|---|
| RYR1 | P4973L | Malignant hyperthermia | High | 9 | 12208234, 23558838, 25637381, 25957634 |
To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.
| RYR2 | ELRDQQEQVKEDMETKCFICGIGNDYFDTV>P<HGFETHTLQEHNLANYLFFLMYLINKDETE | 4932 |
| RYR1 | ELRDQQEQVKEDMETKCFICGIGSDYFDTT>P<HGFETHTLEEHNLANYMFFLMYLINKDETE | 5003 |
| RYR3 | ELRDQQEQVREDMETKCFICGIGNDYFDTT>P<HGFETHTLQEHNLANYLFFLMYLINKDETE | 4835 |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.P4902L | c.14705C>T | Inherited Arrhythmia | CPVT | SIFT: deleterious Polyphen: possibly damaging | |
| Reports | Inherited Arrhythmia | CPVT | Molecular genetics of exercise-induced polymorphic ventricular tachycardia: identification of three novel cardiac ryanodine receptor mutations and two common calsequestrin 2 amino-acid polymorphisms. Eur J Hum Genet. 2003 11(11):888-91. 14571276 | ||
| Inherited Arrhythmia | CPVT | Mutations of the cardiac ryanodine receptor (RyR2) gene in familial polymorphic ventricular tachycardia. Circulation. 2001 103(4):485-90. 11157710 | |||
| Inherited Arrhythmia | CPVT | New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405 | |||
| p.P4902S | c.14704C>T | Inherited Arrhythmia | CPVT | SIFT: deleterious Polyphen: benign | |
| Reports | Inherited Arrhythmia | CPVT | Catecholaminergic polymorphic ventricular tachycardia: RYR2 mutations, bradycardia, and follow up of the patients. J Med Genet. 2005 42(11):863-70. 16272262 | ||
| Inherited Arrhythmia | CPVT | The role of stress test for predicting genetic mutations and future cardiac events in asymptomatic relatives of catecholaminergic polymorphic ventricular tachycardia probands. Europace. 2012 14(9):1344-51. doi: 10.1093/europace/eus031. 22383456 | |||
| Inherited Arrhythmia | CPVT | New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405 | |||