Paralogue Annotation for RYR2 residue 4905

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 4905
Reference Amino Acid: F - Phenylalanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 4905

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1F4976LMyopathy, congenitalHigh9 24706162, 25882082, 25356970

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2DQQEQVKEDMETKCFICGIGNDYFDTVPHG>F<ETHTLQEHNLANYLFFLMYLINKDETEHTG4935
RYR1DQQEQVKEDMETKCFICGIGSDYFDTTPHG>F<ETHTLEEHNLANYMFFLMYLINKDETEHTG5006
RYR3DQQEQVREDMETKCFICGIGNDYFDTTPHG>F<ETHTLQEHNLANYLFFLMYLINKDETEHTG4838
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F4905Lc.14713T>C Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Next generation diagnostics in inherited arrhythmia syndromes : a comparison of two approaches. J Cardiovasc Transl Res. 2013 6(1):94-103. doi: 10.1007/s12265-012-9401-8. 22956155