Paralogue Annotation for RYR2 residue 534

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 534
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 534

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1Y522SMalignant hyperthermiaHigh9 7829078, 11524458, 21825032, 12161072, 9334205, 9873004, 23704352
RYR1Y522CMalignant hyperthermiaHigh9 16244001

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2RLHVYSSAAHFADVAGREAGESWKSILNSL>Y<ELLAALIRGNRKNCAQFSGSLDWLISRLER564
RYR1RLNVYTTAAHFAEFAGEEAAESWKEIVNLL>Y<ELLASLIRGNRSNCALFSTNLDWLVSKLDR552
RYR3RLNVYNSVAHFAGIAREESGMAWKEILNLL>Y<KLLAALIRGNRNNCAQFSNNLDWLISKLDR551
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y534Hc.1600T>C Putative BenignSIFT: deleterious
Polyphen: probably damaging