Paralogue Annotation for RYR2 residue 670

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 670
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 670

No paralogue variants have been mapped to residue 670 for RYR2.



RYR2RDLLLQTRLVNHVSSMRPNIFLGVSEGSAQ>Y<KKWYYELMVDHTEPFVTAEATHLRVGWAST700
RYR1RELLLQTNLINYVTSIRPNIFVGRAEGTTQ>Y<SKWYFEVMVDEVTPFLTAQATHLRVGWALT688
RYR3RNLLLQTRLINDVTSIRPNIFLGVAEGSAQ>Y<KKWYFELIIDQVDPFLTAEPTHLRVGWASS687
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y670Cc.2009A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging