Paralogue Annotation for RYR2 residue 758

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 758
Reference Amino Acid: C - Cysteine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 758

No paralogue variants have been mapped to residue 758 for RYR2.



RYR2DGLHLWSGCIARTVSSPNQHLLRTDDVISC>C<LDLSAPSISFRINGQPVQGMFENFNIDGLF788
RYR1DGLHLWTGHVARPVTSPGQHLLAPEDVISC>C<LDLSVPSISFRINGCPVQGVFESFNLDGLF776
RYR3DGLHLWSGRIPRAVASINQHLLRSDDVVSC>C<LDLGVPSISFRINGQPVQGMFENFNTDGLF775
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C758Sc.2273G>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging