Paralogue Annotation for RYR2 residue 76

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 76
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 76

No paralogue variants have been mapped to residue 76 for RYR2.



RYR2LCFLESTSNSKNVPPDLSICTFVLEQSLSV>R<ALQEMLANTVEKSEGQVDVEKWKFMMKTAQ106
RYR1LCFLEPTSNAQNVPPDLAICCFVLEQSLSV>R<ALQEMLANTVEAG--V---E-------SSQ93
RYR3LCFLEPTSEAKYIPPDLCVCNFVLEQSLSV>R<ALQEMLANTGENG-GE---G-------AAQ96
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R76Wc.226C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging