Paralogue Annotation for RYR2 residue 798

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 798
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 798

No paralogue variants have been mapped to residue 798 for RYR2.



RYR2FRINGQPVQGMFENFNIDGLFFPVVSFSAG>I<KVRFLLGGRHGEFKFLPPPGYAPCYEAVLP828
RYR1FRINGCPVQGVFESFNLDGLFFPVVSFSAG>V<KVRFLLGGRHGEFKFLPPPGYAPCHEAVLP816
RYR3FRINGQPVQGMFENFNTDGLFFPVMSFSAG>V<KVRFLMGGRHGEFKFLPPSGYAPCYEALLP815
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I798Tc.2393T>C Putative BenignSIFT: deleterious
Polyphen: possibly damaging
p.I798Mc.2394A>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging