Paralogue Annotation for RYR2 residue 841

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 841
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 841

No paralogue variants have been mapped to residue 841 for RYR2.



RYR2FKFLPPPGYAPCYEAVLPKEKLKVEHSREY>K<QERTYTRDLLGPTVSLTQAAFTPIPVDTSQ871
RYR1FKFLPPPGYAPCHEAVLPRERLHLEPIKEY>R<REGPRGPHLVGPSRCLSHTDFVPCPVDTVQ859
RYR3FKFLPPSGYAPCYEALLPKEKMRLEPVKEY>K<RDADGIRDLLGTTQFLSQASFIPCPVDTSQ858
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K841Ec.2521A>G Putative BenignSIFT: tolerated
Polyphen: possibly damaging