Paralogue Annotation for RYR2 residue 858

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 858
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 858

No paralogue variants have been mapped to residue 858 for RYR2.



RYR2PKEKLKVEHSREYKQERTYTRDLLGPTVSL>T<QAAFTPIPVDTSQIVLPPHLERIREKLAEN888
RYR1PRERLHLEPIKEYRREGPRGPHLVGPSRCL>S<HTDFVPCPVDTVQIVLPPHLERIREKLAEN876
RYR3PKEKMRLEPVKEYKRDADGIRDLLGTTQFL>S<QASFIPCPVDTSQVILPPHLEKIRDRLAEN875
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T858Mc.2573C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging