Paralogue Annotation for RYR2 residue 887

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 887
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 887

No paralogue variants have been mapped to residue 887 for RYR2.



RYR2LTQAAFTPIPVDTSQIVLPPHLERIREKLA>E<NIHELWVMNKIELGWQYGPVRDDNKRQHPC917
RYR1LSHTDFVPCPVDTVQIVLPPHLERIREKLA>E<NIHELWALTRIEQGWTYGPVRDDNKRLHPC905
RYR3LSQASFIPCPVDTSQVILPPHLEKIRDRLA>E<NIHELWGMNKIELGWTFGKIRDDNKRQHPC904
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E887Kc.2659G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging