Paralogue Annotation for RYR2 residue 901

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 901
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 901

No paralogue variants have been mapped to residue 901 for RYR2.



RYR2QIVLPPHLERIREKLAENIHELWVMNKIEL>G<WQYGPVRDDNKRQHPCLVEFSKLPEQERNY931
RYR1QIVLPPHLERIREKLAENIHELWALTRIEQ>G<WTYGPVRDDNKRLHPCLVDFHSLPEPERNY919
RYR3QVILPPHLEKIRDRLAENIHELWGMNKIEL>G<WTFGKIRDDNKRQHPCLVEFSKLPETEKNY918
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G901Sc.2701G>A Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Candidate colorectal cancer predisposing gene variants in Chinese early-onset and familial cases. World J Gastroenterol. 2015 21(14):4136-49. doi: 10.3748/wjg.v21.i14.4136. 25892863