Paralogue Annotation for RYR2 residue 904

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 904
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 904

No paralogue variants have been mapped to residue 904 for RYR2.



RYR2LPPHLERIREKLAENIHELWVMNKIELGWQ>Y<GPVRDDNKRQHPCLVEFSKLPEQERNYNLQ934
RYR1LPPHLERIREKLAENIHELWALTRIEQGWT>Y<GPVRDDNKRLHPCLVDFHSLPEPERNYNLQ922
RYR3LPPHLEKIRDRLAENIHELWGMNKIELGWT>F<GKIRDDNKRQHPCLVEFSKLPETEKNYNLQ921
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y904Cc.2711A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging