Paralogue Annotation for RYR2 residue 91

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 91
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 91

No paralogue variants have been mapped to residue 91 for RYR2.



RYR2DLSICTFVLEQSLSVRALQEMLANTVEKSE>G<QVDVEKWKFMMKTAQGGGHRTLLYGHAILL121
RYR1DLAICCFVLEQSLSVRALQEMLANTVEAG->-<V---E-------SSQGGGHRTLLYGHAILL108
RYR3DLCVCNFVLEQSLSVRALQEMLANTGENG->G<E---G-------AAQGGGHRTLLYGHAVLL111
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G91Rc.271G>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging