Paralogue Annotation for RYR2 residue 979

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 979
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 979

No paralogue variants have been mapped to residue 979 for RYR2.



RYR2HVGISDEHAEDKVKKMKLPKNYQLTSGYKP>A<PMDLSFIKLTPSQEAMVDKLAENAHNVWAR1009
RYR1HVGMADEKAEDNLKKTKLPKTYMMSNGYKP>A<PLDLSHVRLTPAQTTLVDRLAENGHNVWAR997
RYR3HIAHVNPAAEEDLKKVKLPKNYMMSNGYKP>A<PLDLSDVKLLPPQEILVDKLAENAHNVWAK996
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A979Sc.2935G>T Putative BenignSIFT: deleterious
Polyphen: benign
ReportsUnknown Novel genotype-phenotype associations demonstrated by high-throughput sequencing in patients with hypertrophic cardiomyopathy. Heart. 2015 101(4):294-301. doi: 10.1136/heartjnl-2014-306387. 25351510