Paralogue Annotation for SCN5A residue 1623

Residue details

Gene: SCN5A
Reference Sequences: LRG: LRG_289, Ensembl variant: ENST00000333535 / ENSP00000328968
Amino Acid Position: 1623
Reference Amino Acid: R - Arginine
Protein Domain: TM Domain 4


Paralogue Variants mapped to SCN5A residue 1623

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
SCN1AR1636QLennox-Gastaut syndromeHigh6 17347258
SCN4AR1448SParamyotonia congenitaHigh6 10381583
SCN4AR1448CParamyotonia congenitaHigh6 1316765, 8110459, 8005599, 7809121
SCN4AR1448HParamyotonia congenitaHigh6 1316765, 22507243, 24843232, 8110459, 8005599, 12562902, 7809121
SCN4AR1448PMyotoniaHigh6 7676326, 20038812
SCN4AR1448LParamyotonia congenitaHigh6 18166706
CACNA1FR1296SNight blindness, congenital stationary, incompleteHigh6 15761389, 25525159
CACNA1AR1662HEpisodic ataxia 2High6 10987655, 26814174
SCN8AR1617QIntellectual disability, nonsyndromicHigh6 23020937, 24888894, 25785782, 25046240, 26900580
SCN2AR1626QSeizures, benign infantileHigh6 25473036, 25937001
CACNA1FR1296CNight blindness, congenital stationary, incompleteHigh6 25307992

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in SCN5A.



SCN5A---------------------KYFFSPTLF>R<VIRLARIGRILRLIRGAKGIRTLLFALMMS1653
SCN1A---------------------KYFVSPTLF>R<VIRLARIGRILRLIKGAKGIRTLLFALMMS1666
SCN2A---------------------KYFVSPTLF>R<VIRLARIGRILRLIKGAKGIRTLLFALMMS1656
SCN3A---------------------KYFVSPTLF>R<VIRLARIGRILRLIKGAKGIRTLLFALMMS1651
SCN4A---------------------KYFVSPTLF>R<VIRLARIGRVLRLIRGAKGIRTLLFALMMS1478
SCN7A---------------------SYLVPPSLV>Q<LILLSRIIHMLRLGKGPKVFHNLMLPLMLS1376
SCN8A---------------------KYFVSPTLF>R<VIRLARIGRILRLIKGAKGIRTLLFALMMS1647
SCN9A---------------------TYFVSPTLF>R<VIRLARIGRILRLVKGAKGIRTLLFALMMS1629
SCN10A--------------------LQSYFSPTLF>R<VIRLARIGRILRLIRAAKGIRTLLFALMMS1603
SCN11A--------------------EHIPFPPTLF>R<IVRLARIGRILRLVRAARGIRTLLFALMMS1493
CACNA1A-----------------------FINLSFL>R<LFRA---ARLIKLLRQGYTIRILLWTFVQS1688
CACNA1B---------------------NNFINLSFL>R<LFRA---ARLIKLLRQGYTIRILLWTFVQS1596
CACNA1CE----HTQ----CSPSMNAEENSRISITFF>R<LFRV---MRLVKLLSRGEGIRTLLWTFIKS1356
CACNA1DE----SENVPVPTATPGNSEESNRISITFF>R<LFRV---MRLVKLLSRGEGIRTLLWTFIKS1366
CACNA1E--------------------NTSGFNMSFL>K<LFRA---ARLIKLLRQGYTIRILLWTFVQS1603
CACNA1FG----HLG----E----SSEDSSRISITFF>R<LFRV---MRLVKLLSKGEGIRTLLWTFIKS1323
CACNA1G--------------------ASLPINPTII>R<IMRVLRIARVLKLLKMAVGMRALLDTVMQA1739
CACNA1H--------------------AALPINPTII>R<IMRVLRIARVLKLLKMATGMRALLDTVVQA1745
CACNA1I--------------------AALPINPTII>R<IMRVLRIARVLKLLKMATGMRALLDTVVQA1615
CACNA1SLASSGGLYCLGGGCGNVDPDESARISSAFF>R<LFRV---MRLIKLLSRAEGVRTLLWTFIKS1263
cons                              > <                              

See full Alignment of Paralogues


Known Variants in SCN5A

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1623Lc.4868G>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
p.R1623Qc.4868G>A Inherited ArrhythmiaLQTS,BrSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Phenotypic characterization of a novel long-QT syndrome mutation (R1623Q) in the cardiac sodium channel. Circulation. 1998 97(7):640-4. 9495298
Inherited ArrhythmiaLQTS A de novo missense mutation of human cardiac Na+ channel exhibiting novel molecular mechanisms of long QT syndrome. FEBS Lett. 1998 423(1):5-9. 9506831
Other Cardiac Phenotype A de novo missense mutation (R1623Q) of the SCN5A gene in a Japanese girl with sporadic long QT sydrome. Mutations in brief no. 140. Online. Hum Mutat. 1998 11(6):481. 10200053
Inherited ArrhythmiaLQTS Spectrum of mutations in long-QT syndrome genes. KVLQT1, HERG, SCN5A, KCNE1, and KCNE2. Circulation. 2000 102(10):1178-85. 10973849
Inherited ArrhythmiaLQTS Congenital long QT syndrome and 2:1 atrioventricular block with a mutation of the SCN5A gene. Pediatr Cardiol. 2003 24(1):70-2. 12574983
Inherited ArrhythmiaLQTS Compound mutations: a common cause of severe long-QT syndrome. Circulation. 2004 109(15):1834-41. 15051636
Inherited ArrhythmiaLQTS Recurrent third-trimester fetal loss and maternal mosaicism for long-QT syndrome. Circulation. 2004 109(24):3029-34. 15184283
Inherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
Inherited ArrhythmiaLQTS Differential modulation of late sodium current by protein kinase A in R1623Q mutant of LQT3. Life Sci. 2009 84(11-12):380-7. 19167409
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Impaired stretch modulation in potentially lethal cardiac sodium channel mutants. Channels (Austin). 2010 4(1):12-21. 20090423
Inherited ArrhythmiaBrS An international compendium of mutations in the SCN5A-encoded cardiac sodium channel in patients referred for Brugada syndrome genetic testing. Heart Rhythm. 2010 7(1):33-46. 20129283
Inherited ArrhythmiaLQTS A revised view of cardiac sodium channel "blockade" in the long-QT syndrome. J Clin Invest. 2000 105(8):1133-40. 10772658
Inherited ArrhythmiaBrS Paralogue annotation identifies novel pathogenic variants in patients with Brugada syndrome and catecholaminergic polymorphic ventricular tachycardia. J Med Genet. 2014 51(1):35-44. doi: 10.1136/jmedgenet-2013-101917. 24136861
Inherited Arrhythmia Efficacy of an implantable cardioverter-defibrillator in a neonate with LQT3 associated arrhythmias. Europace. 2005 7(1):77-84. 15670972