Paralogue Annotation for KCNQ1 residue 314

Residue details

Gene: KCNQ1
Reference Sequences: LRG: LRG_287, Ensembl variant: ENST00000155840 / ENSP00000155840
Amino Acid Position: 314
Reference Amino Acid: G - Glycine
Protein Domain: Transmembrane/Linker/Pore


Paralogue Variants mapped to KCNQ1 residue 314

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
KCNQ4G285SDeafness, autosomal dominant 2High9 10025409, 23750663, 25116015
KCNQ4G285CDeafness, autosomal dominant 2High9 10369879, 20832469, 20966080, 23750663
KCNV2G459DCone dystrophy with supernormal rod ERGHigh9 16909397, 23115240
KCNB1G379REpileptic encephalopathyHigh9 25164438, 25164438
KCNQ2G279CEpileptic encephalopathy, type 7High9 25959266

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in KCNQ1.



KCNQ1N-----ESGRVEFGSYADALWWGVVTVTTI>G<YGDKVPQTWVGKTIASCFSVFAISFFALPA344
KCNQ2---------NDHFDTYADALWWGLITLTTI>G<YGDKYPQTWNGRLLAATFTLIGVSFFALPA309
KCNQ3EVDAQGEEMKEEFETYADALWWGLITLATI>G<YGDKTPKTWEGRLIAATFSLIGVSFFALPA348
KCNQ4---------NSDFSSYADSLWWGTITLTTI>G<YGDKTPHTWLGRVLAAGFALLGISFFALPA315
KCNQ5---------NKEFSTYADALWWGTITLTTI>G<YGDKTPLTWLGRLLSAGFALLGISFFALPA343
KCNA1--------AESHFSSIPDAFWWAVVSMTTV>G<YGDMYPVTIGGKIVGSLCAIAGVLTIALPV404
KCNA10--------PESHFSSIPDGFWWAVVTMTTV>G<YGDMCPTTPGGKIVGTLCAIAGVLTIALPV453
KCNA2--------RESQFPSIPDAFWWAVVSMTTV>G<YGDMVPTTIGGKIVGSLCAIAGVLTIALPV406
KCNA3--------PTSGFSSIPDAFWWAVVTMTTV>G<YGDMHPVTIGGKIVGSLCAIAGVLTIALPV476
KCNA4--------PTTHFQSIPDAFWWAVVTMTTV>G<YGDMKPITVGGKIVGSLCAIAGVLTIALPV556
KCNA5--------QGTHFSSIPDAFWWAVVTMTTV>G<YGDMRPITVGGKIVGSLCAIAGVLTIALPV512
KCNA6--------DDSLFPSIPDAFWWAVVTMTTV>G<YGDMYPMTVGGKIVGSLCAIAGVLTIALPV454
KCNA7--------VDSHFTSIPESFWWAVVTMTTV>G<YGDMAPVTVGGKIVGSLCAIAGVLTISLPV390
KCNB1--------DDTKFKSIPASFWWATITMTTV>G<YGDIYPKTLLGKIVGGLCCIAGVLVIALPI409
KCNB2--------DATKFTSIPASFWWATITMTTV>G<YGDIYPKTLLGKIVGGLCCIAGVLVIALPI413
KCNC1QPNDPSASEHTHFKNIPIGFWWAVVTMTTL>G<YGDMYPQTWSGMLVGALCALAGVLTIAMPV432
KCNC2QPNDPSASEHTQFKNIPIGFWWAVVTMTTL>G<YGDMYPQTWSGMLVGALCALAGVLTIAMPV469
KCNC3DPDDILGSNHTYFKNIPIGFWWAVVTMTTL>G<YGDMYPKTWSGMLVGALCALAGVLTIAMPV535
KCNC4RPSDPRGNDHTDFKNIPIGFWWAVVTMTTL>G<YGDMYPKTWSGMLVGALCALAGVLTIAMPV468
KCND1--------NKTNFTSIPAAFWYTIVTMTTL>G<YGDMVPSTIAGKIFGSICSLSGVLVIALPV404
KCND2--------SASKFTSIPAAFWYTIVTMTTL>G<YGDMVPKTIAGKIFGSICSLSGVLVIALPV402
KCND3--------SASKFTSIPASFWYTIVTMTTL>G<YGDMVPKTIAGKIFGSICSLSGVLVIALPV399
KCNF1--------PETLFKSIPQSFWWAIITMTTV>G<YGDIYPKTTLGKLNAAISFLCGVIAIALPI402
KCNG1----A---DSPEFTSIPACYWWAVITMTTV>G<YGDMVPRSTPGQVVALSSILSGILLMAFPV456
KCNG2----G---ARRDFSSVPASYWWAVISMTTV>G<YGDMVPRSLPGQVVALSSILSGILLMAFPV401
KCNG3----DLETSNKDFTSIPAACWWVIISMTTV>G<YGDMYPITVPGRILGGVCVVSGIVLLALPI405
KCNG4----G---RVLEFTSIPASYWWAIISMTTV>G<YGDMVPRSVPGQMVALSSILSGILIMAFPA450
KCNS1---------DVGFNTIPACWWWGTVSMTTV>G<YGDVVPVTVAGKLAASGCILGGILVVALPI453
KCNS2---------NEGLATIPACWWWATVSMTTV>G<YGDVVPGTTAGKLTASACILAGILVVVLPI406
KCNS3--------HTSSLTSIPICWWWATISMTTV>G<YGDTHPVTLAGKLIASTCIICGILVVALPI402
KCNV1--------PDTTFTSVPCAWWWATTSMTTV>G<YGDIRPDTTTGKIVAFMCILSGILVLALPI424
KCNV2--------PSTNFTTIPHSWWWAAVSISTV>G<YGDMYPETHLGRFFAFLCIAFGIILNGMPI489
cons                              > <                              

See full Alignment of Paralogues


Known Variants in KCNQ1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G314Ac.941G>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Additional gene variants reduce effectiveness of beta-blockers in the LQT1 form of long QT syndrome. J Cardiovasc Electrophysiol. 2004 15(2):190-9. 15028050
Inherited ArrhythmiaLQTS Mutation site-specific differences in arrhythmic risk and sensitivity to sympathetic stimulation in the LQT1 form of congenital long QT syndrome: multicenter study in Japan. J Am Coll Cardiol. 2004 44(1):117-25. 15234419
p.G314Cc.940G>T Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS KCNQ1 mutations in patients with a family history of lethal cardiac arrhythmias and sudden death. Clin Genet. 2003 63(4):273-82. 12702160
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
p.G314Dc.941G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS The use of genotype-phenotype correlations in mutation analysis for the long QT syndrome. J Med Genet. 2003 40(2):141-5. 12566525
Inherited ArrhythmiaLQTS Spectrum and frequency of cardiac channel defects in swimming-triggered arrhythmia syndromes. Circulation. 2004 110(15):2119-24. 15466642
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
p.G314Rc.940G>C Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
p.G314Sc.940G>A Inherited ArrhythmiaLQTSSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaLQTS KVLQT1 mutations in three families with familial or sporadic long QT syndrome. Hum Mol Genet. 1996 5(9):1319-24. 8872472
Inherited ArrhythmiaLQTS KVLQT1 C-terminal missense mutation causes a forme fruste long-QT syndrome. Circulation. 1997 96(9):2778-81. 9386136
Inherited ArrhythmiaLQTS Genomic structure of three long QT syndrome genes: KVLQT1, HERG, and KCNE1. Genomics. 1998 51(1):86-97. 9693036
Inherited ArrhythmiaLQTS Genomic organization and mutational analysis of KVLQT1, a gene responsible for familial long QT syndrome. Hum Genet. 1998 103(3):290-4. 9799083
Inherited ArrhythmiaLQTS Novel KCNQ1 and HERG missense mutations in Dutch long-QT families. Hum Mutat. 1999 13(4):301-10. 10220144
Inherited ArrhythmiaLQTS The use of genotype-phenotype correlations in mutation analysis for the long QT syndrome. J Med Genet. 2003 40(2):141-5. 12566525
Inherited ArrhythmiaLQTS Additional gene variants reduce effectiveness of beta-blockers in the LQT1 form of long QT syndrome. J Cardiovasc Electrophysiol. 2004 15(2):190-9. 15028050
Inherited ArrhythmiaLQTS Compound mutations: a common cause of severe long-QT syndrome. Circulation. 2004 109(15):1834-41. 15051636
Inherited ArrhythmiaLQTS Compendium of cardiac channel mutations in 541 consecutive unrelated patients referred for long QT syndrome genetic testing. Heart Rhythm. 2005 2(5):507-17. 15840476
Inherited ArrhythmiaLQTS [Relationship between congenital long QT syndrome and Brugada syndrome gene mutation]. Zhongguo Yi Xue Ke Xue Yuan Xue Bao. 2005 27(3):289-94. 16038262
Inherited ArrhythmiaLQTS Spectrum of pathogenic mutations and associated polymorphisms in a cohort of 44 unrelated patients with long QT syndrome. Clin Genet. 2006 70(3):214-27. 16922724
Inherited ArrhythmiaLQTS The G314S KCNQ1 mutation exerts a dominant-negative effect on expression of KCNQ1 channels in oocytes. Biochem Biophys Res Commun. 2009 383(2):206-9. 19348785
Inherited ArrhythmiaLQTS Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085
Inherited ArrhythmiaLQTS Genetic testing for long-QT syndrome: distinguishing pathogenic mutations from benign variants. Circulation. 2009 120(18):1752-60. 19841300
Inherited ArrhythmiaLQTS Mutation site-specific differences in arrhythmic risk and sensitivity to sympathetic stimulation in the LQT1 form of congenital long QT syndrome: multicenter study in Japan. J Am Coll Cardiol. 2004 44(1):117-25. 15234419
Inherited ArrhythmiaLQTS Clinical aspects of type-1 long-QT syndrome by location, coding type, and biophysical function of mutations involving the KCNQ1 gene. Circulation. 2007 115(19):2481-9. 17470695
Inherited ArrhythmiaLQTS Phylogenetic and physicochemical analyses enhance the classification of rare nonsynonymous single nucleotide variants in type 1 and 2 long-QT syndrome. Circ Cardiovasc Genet. 2012 5(5):519-28. doi: 10.1161/CIRCGENETICS.112.963785. 22949429
Inherited ArrhythmiaLQTS Properties of KvLQT1 K+ channel mutations in Romano-Ward and Jervell and Lange-Nielsen inherited cardiac arrhythmias. EMBO J. 1997 16(17):5472-9. 9312006