No paralogue variants have been mapped to residue 611 for KCNQ1.
| KCNQ1 | KDRGSNTIGARLNRVEDKVTQLDQRLALIT>D<MLHQLLSLHGGS----------------TP | 625 |
| KCNQ2 | ELPEDPSMMGRLGKVEKQVLSMEKKLDFLV>N<IYMQRMGIPPTE--TEAYFG--AKEPEPAP | 668 |
| KCNQ3 | EI-EDQSMMGKFVKVERQVQDMGKKLDFLV>D<MHMQHMERLQVQ--VTE--------YYPTK | 661 |
| KCNQ4 | EVVDEISMMGRVVKVEKQVQSIEHKLDLLL>G<FYSRCLRSGTSA--SLGAVQVPLFDPDITS | 666 |
| KCNQ5 | ETTDDLSMLGRVVKVEKQVQSIESKLDCLL>D<IYQQVLRKGSASALALASFQIPPFECEQTS | 655 |
| KCNA1 | ------------------------------>-<------------------------------ | |
| KCNA10 | ------------------------------>-<------------------------------ | |
| KCNA2 | ------------------------------>-<------------------------------ | |
| KCNA3 | ------------------------------>-<------------------------------ | |
| KCNA4 | ------------------------------>-<------------------------------ | |
| KCNA5 | ------------------------------>-<------------------------------ | |
| KCNA6 | ------------------------------>-<------------------------------ | |
| KCNA7 | ------------------------------>-<------------------------------ | |
| KCNB1 | ------------------------------>-<------------------------------ | |
| KCNB2 | ------------------------------>-<------------------------------ | |
| KCNC1 | ------------------------------>-<------------------------------ | |
| KCNC2 | ------------------------------>-<------------------------------ | |
| KCNC3 | ------------------------------>-<------------------------------ | |
| KCNC4 | ------------------------------>-<------------------------------ | |
| KCND1 | ------------------------------>-<------------------------------ | |
| KCND2 | ------------------------------>-<------------------------------ | |
| KCND3 | ------------------------------>-<------------------------------ | |
| KCNF1 | ------------------------------>-<------------------------------ | |
| KCNG1 | ------------------------------>-<------------------------------ | |
| KCNG2 | ------------------------------>-<------------------------------ | |
| KCNG3 | ------------------------------>-<------------------------------ | |
| KCNG4 | ------------------------------>-<------------------------------ | |
| KCNS1 | ------------------------------>-<------------------------------ | |
| KCNS2 | ------------------------------>-<------------------------------ | |
| KCNS3 | ------------------------------>-<------------------------------ | |
| KCNV1 | ------------------------------>-<------------------------------ | |
| KCNV2 | ------------------------------>-<------------------------------ | |
| cons | > < |
| Protein | CDS | Disease Classification | Disease | dbSNP links | Effect Prediction |
|---|---|---|---|---|---|
| p.D611N | c.1831G>A | Inherited Arrhythmia | LQTS | rs147445322 | SIFT: tolerated Polyphen: possibly damaging |
| Reports | Inherited Arrhythmia | LQTS | Spectrum and prevalence of mutations from the first 2,500 consecutive unrelated patients referred for the FAMILION long QT syndrome genetic test. Heart Rhythm. 2009 6(9):1297-303. 19716085 | ||
| Inherited Arrhythmia | LQTS | The genetic basis of long QT and short QT syndromes: a mutation update. Hum Mutat. 2009 30(11):1486-511. 19862833 | |||
| Inherited Arrhythmia | LQTS | High prevalence of genetic variants previously associated with LQT syndrome in new exome data. Eur J Hum Genet. 2012 20(8):905-8. doi: 10.1038/ejhg.2012.23. 22378279 | |||
| Unknown | Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381 | ||||
| Inherited Arrhythmia | LQTS | Rare genetic variants previously associated with congenital forms of long QT syndrome have little or no effect on the QT interval. Eur Heart J. 2015 36(37):2523-9. doi: 10.1093/eurheartj/ehv297. 26159999 | |||
| p.D611Y | c.1831G>T | Inherited Arrhythmia | LQTS | rs147445322 | SIFT: tolerated Polyphen: benign |
| Reports | Inherited Arrhythmia | LQTS | Q-T peak dispersion in congenital long QT syndrome: possible marker of mutation of HERG. Circ J. 2003 67(6):495-8. 12808265 | ||
| Inherited Arrhythmia | LQTS | Compound heterozygosity for mutations Asp611-->Tyr in KCNQ1 and Asp609-->Gly in KCNH2 associated with severe long QT syndrome. Clin Sci (Lond). 2005 108(2):143-50. 15500450 | |||
| Inherited Arrhythmia | LQTS | Mutation site-specific differences in arrhythmic risk and sensitivity to sympathetic stimulation in the LQT1 form of congenital long QT syndrome: multicenter study in Japan. J Am Coll Cardiol. 2004 44(1):117-25. 15234419 | |||
| Inherited Arrhythmia | LQTS | Clinical aspects of type-1 long-QT syndrome by location, coding type, and biophysical function of mutations involving the KCNQ1 gene. Circulation. 2007 115(19):2481-9. 17470695 | |||